SCOP 1.69: Domain d1nnva_: 1nnv A:

Lineage for d1nnva_ (1nnv A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.7: Putative dsDNA mimic [102816] (1 family)
   elaborated with additional structures; some similarity to Uracil-DNA glycosylase (UGI) and Nuclease A (NuiA) inhibitors

5. Family d.17.7.1: Putative dsDNA mimic [102817] (1 protein)
   Pfam 04269, DUF440

6. Protein Hypothetical protein HI1450 [102818] (1 species)
   putative dsDNA mimic

7. Species Haemophilus influenzae [TaxId:727] [102819] (1 PDB entry)

8. Domain d1nnva_: 1nnv A: [92012]
   structural genomics

Details for d1nnva_

PDB Entry: 1nnv

PDB Description: the solution structure of hi1450

SCOP Domain Sequences for d1nnva_:

Sequence; same for both SEQRES and ATOM records:

>d1nnva_ d.17.7.1 (A:) Hypothetical protein HI1450 {Haemophilus influenzae}
mtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddweeei
gvlidpeeyaevwvglvneqdemddvfakflishreedrefhviwkk

Timeline for d1nnva_:

• d1nnva_ first appeared in SCOP 1.67
  
• d1nnva_ appears in SCOP 1.71
  
• d1nnva_ appears in the current release, SCOPe 2.08