Lineage for d1nnva_ (1nnv A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409317Superfamily d.17.7: Putative dsDNA mimic [102816] (1 family) (S)
    elaborated with additional structures; some similarity to Uracil-DNA glycosylase (UGI) and Nuclease A (NuiA) inhibitors
  5. 409318Family d.17.7.1: Putative dsDNA mimic [102817] (1 protein)
    Pfam 04269, DUF440
  6. 409319Protein Hypothetical protein HI1450 [102818] (1 species)
    putative dsDNA mimic
  7. 409320Species Haemophilus influenzae [TaxId:727] [102819] (1 PDB entry)
  8. 409321Domain d1nnva_: 1nnv A: [92012]
    structural genomics

Details for d1nnva_

PDB Entry: 1nnv (more details)

PDB Description: the solution structure of hi1450

SCOP Domain Sequences for d1nnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnva_ d.17.7.1 (A:) Hypothetical protein HI1450 {Haemophilus influenzae}
mtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddweeei
gvlidpeeyaevwvglvneqdemddvfakflishreedrefhviwkk

SCOP Domain Coordinates for d1nnva_:

Click to download the PDB-style file with coordinates for d1nnva_.
(The format of our PDB-style files is described here.)

Timeline for d1nnva_: