SCOP 1.69: Domain d1nnrb_: 1nnr B:

Lineage for d1nnrb_ (1nnr B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)

8. Domain d1nnrb_: 1nnr B: [92011]

Details for d1nnrb_

PDB Entry: 1nnr, 2.25 Å

PDB Description: crystal structure of a probable fosfomycin resistance protein (pa1129) from pseudomonas aeruginosa with sulfate present in the active site

SCOP Domain Sequences for d1nnrb_:

Sequence; same for both SEQRES and ATOM records:

>d1nnrb_ d.32.1.2 (B:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

Timeline for d1nnrb_:

• d1nnrb_ first appeared in SCOP 1.67
  
• d1nnrb_ appears in SCOP 1.71
  
• d1nnrb_ appears in the current release, SCOPe 2.08