SCOPe 2.05: Domain d1nnra_: 1nnr A:

Lineage for d1nnra_ (1nnr A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)

8. Domain d1nnra_: 1nnr A: [92010]
   complexed with mn, so4

Details for d1nnra_

PDB Entry: 1nnr, 2.25 Å

PDB Description: crystal structure of a probable fosfomycin resistance protein (pa1129) from pseudomonas aeruginosa with sulfate present in the active site

PDB Compounds: (A:) probable fosfomycin resistance protein

SCOPe Domain Sequences for d1nnra_:

Sequence; same for both SEQRES and ATOM records:

>d1nnra_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

Timeline for d1nnra_:

• d1nnra_ first appeared in SCOP 1.67
  
• d1nnra_ appears in SCOPe 2.04
  
• d1nnra_ appears in SCOPe 2.06
  
• d1nnra_ appears in the current release, SCOPe 2.08