![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Fosfomycin resistance protein A (FosA) [82630] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries) |
![]() | Domain d1nnra_: 1nnr A: [92010] |
PDB Entry: 1nnr (more details), 2.25 Å
SCOP Domain Sequences for d1nnra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnra_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa} mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl aacrqapyagmrfa
Timeline for d1nnra_: