Lineage for d1nnra_ (1nnr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942460Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)
  7. 2942461Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)
  8. 2942470Domain d1nnra_: 1nnr A: [92010]
    complexed with mn, so4

Details for d1nnra_

PDB Entry: 1nnr (more details), 2.25 Å

PDB Description: crystal structure of a probable fosfomycin resistance protein (pa1129) from pseudomonas aeruginosa with sulfate present in the active site
PDB Compounds: (A:) probable fosfomycin resistance protein

SCOPe Domain Sequences for d1nnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnra_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

SCOPe Domain Coordinates for d1nnra_:

Click to download the PDB-style file with coordinates for d1nnra_.
(The format of our PDB-style files is described here.)

Timeline for d1nnra_: