SCOPe 2.06: Domain d1nnqa2: 1nnq A:135-171

Lineage for d1nnqa2 (1nnq A:135-171)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubrerythrin, C-terminal domain [57811] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)

8. Domain d1nnqa2: 1nnq A:135-171 [92007]
   Other proteins in same PDB: d1nnqa1, d1nnqb1
   structural genomics
   complexed with zn

Details for d1nnqa2

PDB Entry: 1nnq, 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1nnqa2:

Sequence; same for both SEQRES and ATOM records:

>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

Timeline for d1nnqa2:

• d1nnqa2 first appeared in SCOP 1.67
  
• d1nnqa2 appears in SCOPe 2.05
  
• d1nnqa2 appears in SCOPe 2.07
  
• d1nnqa2 appears in the current release, SCOPe 2.08