Lineage for d1nnha_ (1nnh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574338Protein Hypothetical protein PF1951 [103157] (1 species)
  7. 2574339Species Pyrococcus furiosus [TaxId:2261] [103158] (1 PDB entry)
    AspRS-related protein
  8. 2574340Domain d1nnha_: 1nnh A: [92005]
    structural genomics
    complexed with na

Details for d1nnha_

PDB Entry: 1nnh (more details), 1.65 Å

PDB Description: hypothetical protein from pyrococcus furiosus pfu-1801964
PDB Compounds: (A:) asparaginyl-tRNA synthetase-related peptide

SCOPe Domain Sequences for d1nnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Pyrococcus furiosus [TaxId: 2261]}
naveiisreisptldiqtkileymtdffvkegfkwllpviispitdplwpdpagegmepa
eveiygvkmrlthsmilhkqlaiamglkkifvlspnirlesrqkddgrhayeftqldfev
erakmedimrlierlvyglfrkaeewtgrefpktkrfevfeysevleefgsdekasqeme
epfwiiniprefydrevdgfwrnydlilpygygevasggereweyekivakirkaglned
sfrpyleiakagklkpsagagigverlvrfivgakhiaevqpfpripgipavi

SCOPe Domain Coordinates for d1nnha_:

Click to download the PDB-style file with coordinates for d1nnha_.
(The format of our PDB-style files is described here.)

Timeline for d1nnha_: