Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Hypothetical protein PF1951 [103157] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [103158] (1 PDB entry) AspRS-related protein |
Domain d1nnha_: 1nnh A: [92005] structural genomics complexed with na |
PDB Entry: 1nnh (more details), 1.65 Å
SCOPe Domain Sequences for d1nnha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Pyrococcus furiosus [TaxId: 2261]} naveiisreisptldiqtkileymtdffvkegfkwllpviispitdplwpdpagegmepa eveiygvkmrlthsmilhkqlaiamglkkifvlspnirlesrqkddgrhayeftqldfev erakmedimrlierlvyglfrkaeewtgrefpktkrfevfeysevleefgsdekasqeme epfwiiniprefydrevdgfwrnydlilpygygevasggereweyekivakirkaglned sfrpyleiakagklkpsagagigverlvrfivgakhiaevqpfpripgipavi
Timeline for d1nnha_: