Lineage for d1nngb_ (1nng B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410666Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410667Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 410668Family d.38.1.1: 4HBT-like [54638] (4 proteins)
  6. 410691Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species)
  7. 410692Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry)
  8. 410694Domain d1nngb_: 1nng B: [92004]
    structural genomics
    complexed with ca, coa, gol

Details for d1nngb_

PDB Entry: 1nng (more details), 1.95 Å

PDB Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.

SCOP Domain Sequences for d1nngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nngb_ d.38.1.1 (B:) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae}
ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
vdnngrsrtiprennqelekalaliseq

SCOP Domain Coordinates for d1nngb_:

Click to download the PDB-style file with coordinates for d1nngb_.
(The format of our PDB-style files is described here.)

Timeline for d1nngb_: