Lineage for d1nnga_ (1nng A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601788Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601789Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 601790Family d.38.1.1: 4HBT-like [54638] (5 proteins)
    Pfam 03061
  6. 601818Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species)
  7. 601819Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry)
  8. 601820Domain d1nnga_: 1nng A: [92003]

Details for d1nnga_

PDB Entry: 1nng (more details), 1.95 Å

PDB Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.

SCOP Domain Sequences for d1nnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnga_ d.38.1.1 (A:) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae}
rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi
kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr
srtiprennqelekalalise

SCOP Domain Coordinates for d1nnga_:

Click to download the PDB-style file with coordinates for d1nnga_.
(The format of our PDB-style files is described here.)

Timeline for d1nnga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nngb_