SCOP 1.75: Domain d1nnda_: 1nnd A:

Lineage for d1nnda_ (1nnd A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d1nnda_: 1nnd A: [92002]
   mutant

Details for d1nnda_

PDB Entry: 1nnd, 2.3 Å

PDB Description: arginine 116 is essential for nucleic acid recognition by the fingers domain of moloney murine leukemia virus reverse transcriptase

PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1nnda_:

Sequence; same for both SEQRES and ATOM records:

>d1nnda_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlaevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllk

Timeline for d1nnda_:

• d1nnda_ first appeared in SCOP 1.67
  
• d1nnda_ appears in SCOP 1.73
  
• d1nnda_ appears in SCOPe 2.01
  
• d1nnda_ appears in the current release, SCOPe 2.08