Lineage for d1nnda_ (1nnd A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618491Protein MMLV reverse transcriptase [56687] (1 species)
  7. 618492Species Moloney murine leukaemia virus, MoMLV [56688] (9 PDB entries)
  8. 618496Domain d1nnda_: 1nnd A: [92002]
    mutant

Details for d1nnda_

PDB Entry: 1nnd (more details), 2.3 Å

PDB Description: arginine 116 is essential for nucleic acid recognition by the fingers domain of moloney murine leukemia virus reverse transcriptase

SCOP Domain Sequences for d1nnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnda_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukaemia virus, MoMLV}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlaevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllk

SCOP Domain Coordinates for d1nnda_:

Click to download the PDB-style file with coordinates for d1nnda_.
(The format of our PDB-style files is described here.)

Timeline for d1nnda_: