![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
![]() | Protein MMLV reverse transcriptase [56687] (1 species) |
![]() | Species Moloney murine leukaemia virus, MoMLV [56688] (9 PDB entries) |
![]() | Domain d1nnda_: 1nnd A: [92002] mutant |
PDB Entry: 1nnd (more details), 2.3 Å
SCOP Domain Sequences for d1nnda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnda_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukaemia virus, MoMLV} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvkkpgtndyrpvqdlaevnkrvedihptvpnpynllsglppsh qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq kqvkylgyllk
Timeline for d1nnda_: