Lineage for d1nn8t_ (1nn8 T:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1711988Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1711989Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1711990Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1712098Protein Poliovirus complexed with three domain CD155 [58169] (1 species)
  7. 1712099Species Human poliovirus type 1 [TaxId:12080] [58170] (2 PDB entries)
  8. 1712106Domain d1nn8t_: 1nn8 T: [92001]
    complexed with myr

Details for d1nn8t_

PDB Entry: 1nn8 (more details), 15 Å

PDB Description: CryoEM structure of poliovirus receptor bound to poliovirus
PDB Compounds: (T:) poliovirus receptor

SCOPe Domain Sequences for d1nn8t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn8t_ i.6.1.1 (T:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
vvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyse
skrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqnt
aevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwil
vpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcda
rsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvq
v

SCOPe Domain Coordinates for d1nn8t_:

Click to download the PDB-style file with coordinates for d1nn8t_.
(The format of our PDB-style files is described here.)

Timeline for d1nn8t_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nn81_, d1nn82_, d1nn83_, d1nn84_, d1nn8r_, d1nn8s_