SCOPe 2.03: Domain d1nn84_: 1nn8 4:

Lineage for d1nn84_ (1nn8 4:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein Poliovirus complexed with three domain CD155 [58169] (1 species)

7. Species Human poliovirus type 1 [TaxId:12080] [58170] (2 PDB entries)

8. Domain d1nn84_: 1nn8 4: [91998]
   complexed with myr

Details for d1nn84_

PDB Entry: 1nn8, 15 Å

PDB Description: CryoEM structure of poliovirus receptor bound to poliovirus

PDB Compounds: (4:) coat protein vp4

SCOPe Domain Sequences for d1nn84_:

Sequence, based on SEQRES records:

>d1nn84_ i.6.1.1 (4:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
gaqvssqkvgahensnrayggstinyttinyyrdsasnaaskqdfsqdpskftepikdvl
iktapmln

Sequence, based on observed residues (ATOM records):

>d1nn84_ i.6.1.1 (4:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
gaqvssqkvgahensstinyttinyyrdsasnaaskqdfsqdpskftepikdvliktapm
ln

Timeline for d1nn84_:

• d1nn84_ first appeared in SCOP 1.67
  
• d1nn84_ appears in SCOPe 2.02
  
• d1nn84_ appears in SCOPe 2.04
  
• d1nn84_ appears in the current release, SCOPe 2.08