Lineage for d1nmva2 (1nmv A:45-163)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408480Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 1408481Species Human (Homo sapiens) [TaxId:9606] [54548] (33 PDB entries)
  8. 1408514Domain d1nmva2: 1nmv A:45-163 [91994]
    Other proteins in same PDB: d1nmva1

Details for d1nmva2

PDB Entry: 1nmv (more details)

PDB Description: solution structure of human pin1
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d1nmva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmva2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
gkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfe
slasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d1nmva2:

Click to download the PDB-style file with coordinates for d1nmva2.
(The format of our PDB-style files is described here.)

Timeline for d1nmva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nmva1