![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54548] (33 PDB entries) |
![]() | Domain d1nmva2: 1nmv A:45-163 [91994] Other proteins in same PDB: d1nmva1 |
PDB Entry: 1nmv (more details)
SCOPe Domain Sequences for d1nmva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmva2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} gkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfe slasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d1nmva2: