Lineage for d1nmra_ (1nmr A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449729Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 449730Superfamily a.144.1: PABC (PABP) domain [63570] (1 family) (S)
  5. 449731Family a.144.1.1: PABC (PABP) domain [63571] (2 proteins)
  6. 449735Protein poly(A) binding protein [63572] (3 species)
  7. 449742Species Protozoan (Trypanosoma cruzi) [TaxId:5693] [101231] (1 PDB entry)
  8. 449743Domain d1nmra_: 1nmr A: [91992]

Details for d1nmra_

PDB Entry: 1nmr (more details)

PDB Description: solution structure of c-terminal domain from trypanosoma cruzi poly(a)-binding protein

SCOP Domain Sequences for d1nmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmra_ a.144.1.1 (A:) poly(A) binding protein {Protozoan (Trypanosoma cruzi)}
gsslasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeiln
lldtpglldakvqealevlnrhmnv

SCOP Domain Coordinates for d1nmra_:

Click to download the PDB-style file with coordinates for d1nmra_.
(The format of our PDB-style files is described here.)

Timeline for d1nmra_: