Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (1 family) di-iron binding protein |
Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (1 protein) Pfam 01784 |
Protein Hypothetical protein YbgI [102707] (1 species) |
Species Escherichia coli [TaxId:562] [102708] (2 PDB entries) |
Domain d1nmpc_: 1nmp C: [91988] |
PDB Entry: 1nmp (more details), 2.2 Å
SCOP Domain Sequences for d1nmpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmpc_ c.135.1.1 (C:) Hypothetical protein YbgI {Escherichia coli} mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf idipnpa
Timeline for d1nmpc_: