SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1nmpc_ (1nmp C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151827Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2151828Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2151829Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 protein domains)
    Pfam PF01784
  6. 2151835Protein Hypothetical protein YbgI [102707] (1 species)
  7. 2151836Species Escherichia coli [TaxId:562] [102708] (2 PDB entries)
  8. 2151845Domain d1nmpc_: 1nmp C: [91988]
    structural genomics
    complexed with mg

Details for d1nmpc_

PDB Entry: 1nmp (more details), 2.2 Å

PDB Description: Structural genomics, ybgI protein, unknown function
PDB Compounds: (C:) Hypothetical protein ybgI

SCOPe Domain Sequences for d1nmpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmpc_ c.135.1.1 (C:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]}
mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav
ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv
mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid
saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf
idipnpa

SCOPe Domain Coordinates for d1nmpc_:

Click to download the PDB-style file with coordinates for d1nmpc_.
(The format of our PDB-style files is described here.)

Timeline for d1nmpc_: