Lineage for d1nmpa_ (1nmp A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405177Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 405178Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (1 family) (S)
    di-iron binding protein
  5. 405179Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (1 protein)
    Pfam 01784
  6. 405180Protein Hypothetical protein YbgI [102707] (1 species)
  7. 405181Species Escherichia coli [TaxId:562] [102708] (2 PDB entries)
  8. 405188Domain d1nmpa_: 1nmp A: [91986]

Details for d1nmpa_

PDB Entry: 1nmp (more details), 2.2 Å

PDB Description: structural genomics, ybgi protein, unknown function

SCOP Domain Sequences for d1nmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmpa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli}
mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav
ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv
mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid
saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf
idipnpa

SCOP Domain Coordinates for d1nmpa_:

Click to download the PDB-style file with coordinates for d1nmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1nmpa_: