SCOPe 2.05: Domain d1nmof_: 1nmo F:

Lineage for d1nmof_ (1nmo F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
   consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest

4. Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families)
   di-iron binding protein

5. Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins)
   Pfam PF01784

6. Protein Hypothetical protein YbgI [102707] (1 species)

7. Species Escherichia coli [TaxId:562] [102708] (2 PDB entries)

8. Domain d1nmof_: 1nmo F: [91985]
   structural genomics
   complexed with fe

Details for d1nmof_

PDB Entry: 1nmo, 2.2 Å

PDB Description: structural genomics, protein ybgi, unknown function

PDB Compounds: (F:) Hypothetical protein ybgI

SCOPe Domain Sequences for d1nmof_:

Sequence; same for both SEQRES and ATOM records:

>d1nmof_ c.135.1.1 (F:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]}
mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav
ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv
mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid
saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf
idipnpa

Timeline for d1nmof_:

• d1nmof_ first appeared in SCOP 1.67
  
• d1nmof_ appears in SCOPe 2.04
  
• d1nmof_ appears in SCOPe 2.06
  
• d1nmof_ appears in the current release, SCOPe 2.08