SCOPe 2.08: Domain d1nmnb_: 1nmn B:

Lineage for d1nmnb_ (1nmn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
   automatically mapped to Pfam PF03652

6. Protein Hypothetical protein YqgF (RuvX) [102486] (1 species)

7. Species Escherichia coli [TaxId:562] [102487] (3 PDB entries)

8. Domain d1nmnb_: 1nmn B: [91979]
   structural genomics

Details for d1nmnb_

PDB Entry: 1nmn, 2.3 Å

PDB Description: Structure of yqgF from Escherichia coli, a hypothetical protein

PDB Compounds: (B:) Hypothetical protein yqgF

SCOPe Domain Sequences for d1nmnb_:

Sequence, based on SEQRES records:

>d1nmnb_ c.55.3.8 (B:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgkv
dsasaviilesyfeqgy

Sequence, based on observed residues (ATOM records):

>d1nmnb_ c.55.3.8 (B:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvdsasaviilesyfeqgy

Timeline for d1nmnb_:

• d1nmnb_ first appeared in SCOP 1.67
  
• d1nmnb_ appears in SCOPe 2.07