Lineage for d1nm5c_ (1nm5 C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580740Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 580741Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 580855Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 580856Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 580864Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)
  8. 580869Domain d1nm5c_: 1nm5 C: [91972]
    Other proteins in same PDB: d1nm5a1, d1nm5a2, d1nm5b1, d1nm5b2
    complexed with dI component
    complexed with gol, nad, nap; mutant

Details for d1nm5c_

PDB Entry: 1nm5 (more details), 2.4 Å

PDB Description: r. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex

SCOP Domain Sequences for d1nm5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm5c_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d1nm5c_:

Click to download the PDB-style file with coordinates for d1nm5c_.
(The format of our PDB-style files is described here.)

Timeline for d1nm5c_: