![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode |
![]() | Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries) |
![]() | Domain d1nm5c_: 1nm5 C: [91972] Other proteins in same PDB: d1nm5a1, d1nm5a2, d1nm5b1, d1nm5b2 complexed with dI component |
PDB Entry: 1nm5 (more details), 2.4 Å
SCOP Domain Sequences for d1nm5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm5c_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum} svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Timeline for d1nm5c_:
![]() Domains from other chains: (mouse over for more information) d1nm5a1, d1nm5a2, d1nm5b1, d1nm5b2 |