SCOP 1.67: Domain d1nm5c_: 1nm5 C:

Lineage for d1nm5c_ (1nm5 C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)

8. Domain d1nm5c_: 1nm5 C: [91972]
   Other proteins in same PDB: d1nm5a1, d1nm5a2, d1nm5b1, d1nm5b2
   complexed with dI component
   complexed with gol, nad, nap; mutant

Details for d1nm5c_

PDB Entry: 1nm5, 2.4 Å

PDB Description: r. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex

SCOP Domain Sequences for d1nm5c_:

Sequence; same for both SEQRES and ATOM records:

>d1nm5c_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1nm5c_:

• d1nm5c_ is new in SCOP 1.67
  
• d1nm5c_ appears in SCOP 1.69
  
• d1nm5c_ appears in the current release, SCOPe 2.08