Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
Domain d1nm5b2: 1nm5 B:1-143,B:327-378 [91971] Other proteins in same PDB: d1nm5a1, d1nm5b1, d1nm5c_ complexed with dIII component complexed with gol, nad, nap; mutant |
PDB Entry: 1nm5 (more details), 2.4 Å
SCOP Domain Sequences for d1nm5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm5b2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisransmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet vsgtcvtrdgaivhpa
Timeline for d1nm5b2: