SCOP 1.73: Domain d1nm5b2: 1nm5 B:1-143,B:327-378

Lineage for d1nm5b2 (1nm5 B:1-143,B:327-378)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d1nm5b2: 1nm5 B:1-143,B:327-378 [91971]
   Other proteins in same PDB: d1nm5a1, d1nm5b1, d1nm5c_
   complexed with dIII component
   complexed with gol, nad, nap; mutant

Details for d1nm5b2

PDB Entry: 1nm5, 2.4 Å

PDB Description: r. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex

PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOP Domain Sequences for d1nm5b2:

Sequence; same for both SEQRES and ATOM records:

>d1nm5b2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisransmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

Timeline for d1nm5b2:

• d1nm5b2 first appeared in SCOP 1.67
  
• d1nm5b2 appears in SCOP 1.71
  
• d1nm5b2 appears in SCOP 1.75
  
• d1nm5b2 appears in the current release, SCOPe 2.08