Lineage for d1nm5a2 (1nm5 A:1-143,A:327-374)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391407Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 391446Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 391452Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 391453Species Rhodospirillum rubrum [TaxId:1085] [63964] (6 PDB entries)
  8. 391466Domain d1nm5a2: 1nm5 A:1-143,A:327-374 [91969]
    Other proteins in same PDB: d1nm5a1, d1nm5b1, d1nm5c_

Details for d1nm5a2

PDB Entry: 1nm5 (more details), 2.4 Å

PDB Description: R. rubrum transhydrogenase (dI.Q132N)2(dIII)1 asymmetric complex

SCOP Domain Sequences for d1nm5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm5a2 c.23.12.2 (A:1-143,A:327-374) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisransmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgai

SCOP Domain Coordinates for d1nm5a2:

Click to download the PDB-style file with coordinates for d1nm5a2.
(The format of our PDB-style files is described here.)

Timeline for d1nm5a2: