Lineage for d1nm5a1 (1nm5 A:144-326)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105396Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2105425Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 2105426Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)
  8. 2105449Domain d1nm5a1: 1nm5 A:144-326 [91968]
    Other proteins in same PDB: d1nm5a2, d1nm5b2, d1nm5c_
    complexed with dIII component
    complexed with gol, nad, nap

Details for d1nm5a1

PDB Entry: 1nm5 (more details), 2.4 Å

PDB Description: r. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex
PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d1nm5a1:

Sequence, based on SEQRES records: (download)

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvakemgeefrkkqaeavlkelvktdiaittalipgkpapvlit
eemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOPe Domain Coordinates for d1nm5a1:

Click to download the PDB-style file with coordinates for d1nm5a1.
(The format of our PDB-style files is described here.)

Timeline for d1nm5a1: