SCOP 1.67: Domain d1nm5a1: 1nm5 A:144-326

Lineage for d1nm5a1 (1nm5 A:144-326)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (6 PDB entries)

8. Domain d1nm5a1: 1nm5 A:144-326 [91968]
   Other proteins in same PDB: d1nm5a2, d1nm5b2, d1nm5c_

Details for d1nm5a1

PDB Entry: 1nm5, 2.4 Å

PDB Description: r. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex

SCOP Domain Sequences for d1nm5a1:

Sequence, based on SEQRES records:

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvakemgeefrkkqaeavlkelvktdiaittalipgkpapvlit
eemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d1nm5a1:

• d1nm5a1 is new in SCOP 1.67
  
• d1nm5a1 appears in SCOP 1.69
  
• d1nm5a1 appears in the current release, SCOPe 2.08