Lineage for d1nm5a1 (1nm5 A:144-326)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388130Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 388159Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 388160Species Rhodospirillum rubrum [TaxId:1085] [63938] (6 PDB entries)
  8. 388173Domain d1nm5a1: 1nm5 A:144-326 [91968]
    Other proteins in same PDB: d1nm5a2, d1nm5b2, d1nm5c_

Details for d1nm5a1

PDB Entry: 1nm5 (more details), 2.4 Å

PDB Description: R. rubrum transhydrogenase (dI.Q132N)2(dIII)1 asymmetric complex

SCOP Domain Sequences for d1nm5a1:

Sequence, based on SEQRES records: (download)

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1nm5a1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvakemgeefrkkqaeavlkelvktdiaittalipgkpapvlit
eemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOP Domain Coordinates for d1nm5a1:

Click to download the PDB-style file with coordinates for d1nm5a1.
(The format of our PDB-style files is described here.)

Timeline for d1nm5a1: