Class b: All beta proteins [48724] (178 folds) |
Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) |
Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins) |
Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain [101560] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101561] (1 PDB entry) |
Domain d1nlta2: 1nlt A:258-337 [91964] Other proteins in same PDB: d1nlta3 complexed with zn |
PDB Entry: 1nlt (more details), 2.7 Å
SCOPe Domain Sequences for d1nlta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp ipkyggygnliikftikdpe
Timeline for d1nlta2: