SCOPe 2.06: Domain d1nlta1: 1nlt A:110-138,A:213-257

Lineage for d1nlta1 (1nlt A:110-138,A:213-257)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)

6. Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain [101560] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101561] (1 PDB entry)

8. Domain d1nlta1: 1nlt A:110-138,A:213-257 [91963]
   Other proteins in same PDB: d1nlta3
   complexed with zn

Details for d1nlta1

PDB Entry: 1nlt, 2.7 Å

PDB Description: the crystal structure of hsp40 ydj1

PDB Compounds: (A:) Mitochondrial protein import protein MAS5

SCOPe Domain Sequences for d1nlta1:

Sequence; same for both SEQRES and ATOM records:

>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pqrgkdikheisasleelykgrtaklalnXrkilevhvepgmkdgqrivfkgeadqapdv
ipgdvvfivserphk

Timeline for d1nlta1:

• d1nlta1 first appeared in SCOP 1.67
  
• d1nlta1 appears in SCOPe 2.05
  
• d1nlta1 appears in SCOPe 2.07
  
• d1nlta1 appears in the current release, SCOPe 2.08