Lineage for d1nlta1 (1nlt A:110-138,A:213-257)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369090Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 369091Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (1 family) (S)
  5. 369092Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)
  6. 369097Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain [101560] (1 species)
  7. 369098Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101561] (1 PDB entry)
  8. 369099Domain d1nlta1: 1nlt A:110-138,A:213-257 [91963]
    Other proteins in same PDB: d1nlta3

Details for d1nlta1

PDB Entry: 1nlt (more details), 2.7 Å

PDB Description: the crystal structure of hsp40 ydj1

SCOP Domain Sequences for d1nlta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
pqrgkdikheisasleelykgrtaklalnXrkilevhvepgmkdgqrivfkgeadqapdv
ipgdvvfivserphk

SCOP Domain Coordinates for d1nlta1:

Click to download the PDB-style file with coordinates for d1nlta1.
(The format of our PDB-style files is described here.)

Timeline for d1nlta1: