Lineage for d1nlna_ (1nln A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192326Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1192327Protein Human adenovirus 2 proteinase, adenain [54055] (1 species)
  7. 1192328Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries)
  8. 1192330Domain d1nlna_: 1nln A: [91962]
    complexed with peptide cofactor, chain B
    complexed with acy

Details for d1nlna_

PDB Entry: 1nln (more details), 1.6 Å

PDB Description: crystal structure of human adenovirus 2 proteinase with its 11 amino acid cofactor at 1.6 angstrom resolution
PDB Compounds: (A:) Adenain

SCOPe Domain Sequences for d1nlna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlna_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
gsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafawn
prsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsaa
cglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerh
spyfrshsaqirsatsfchlknm

SCOPe Domain Coordinates for d1nlna_:

Click to download the PDB-style file with coordinates for d1nlna_.
(The format of our PDB-style files is described here.)

Timeline for d1nlna_: