Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
Protein Human adenovirus 2 proteinase, adenain [54055] (1 species) |
Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries) |
Domain d1nlna_: 1nln A: [91962] complexed with peptide cofactor, chain B complexed with acy |
PDB Entry: 1nln (more details), 1.6 Å
SCOPe Domain Sequences for d1nlna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlna_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]} gsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafawn prsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsaa cglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerh spyfrshsaqirsatsfchlknm
Timeline for d1nlna_: