SCOPe 2.04: Domain d1nl0l2: 1nl0 L:109-210

Lineage for d1nl0l2 (1nl0 L:109-210)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1nl0l2: 1nl0 L:109-210 [91948]
   Other proteins in same PDB: d1nl0g_, d1nl0h1, d1nl0h2, d1nl0l1
   part of Fab 10c12 against factor IX Gla domain
   complexed with ca, so4

Details for d1nl0l2

PDB Entry: 1nl0, 2.2 Å

PDB Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12

PDB Compounds: (L:) anti-factor IX antibody, 10C12, chain L

SCOPe Domain Sequences for d1nl0l2:

Sequence; same for both SEQRES and ATOM records:

>d1nl0l2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d1nl0l2:

• d1nl0l2 first appeared in SCOP 1.67
  
• d1nl0l2 appears in SCOPe 2.03
  
• d1nl0l2 appears in SCOPe 2.05
  
• d1nl0l2 appears in the current release, SCOPe 2.08