![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1nl0h2: 1nl0 H:114-217 [91946] Other proteins in same PDB: d1nl0g_, d1nl0h1, d1nl0l1, d1nl0l2 part of Fab 10c12 against factor IX Gla domain complexed with ca, so4 |
PDB Entry: 1nl0 (more details), 2.2 Å
SCOP Domain Sequences for d1nl0h2:
Sequence, based on SEQRES records: (download)
>d1nl0h2 b.1.1.2 (H:114-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
>d1nl0h2 b.1.1.2 (H:114-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv vtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
Timeline for d1nl0h2: