SCOPe 2.07: Domain d1nkia_: 1nki A:

Lineage for d1nkia_ (1nki A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Fosfomycin resistance protein A (FosA) [82630] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82631] (5 PDB entries)

8. Domain d1nkia_: 1nki A: [91941]
   complexed with k, mn, ppf

Details for d1nkia_

PDB Entry: 1nki, 0.95 Å

PDB Description: crystal structure of the fosfomycin resistance protein a (fosa) containing bound phosphonoformate

PDB Compounds: (A:) probable fosfomycin resistance protein

SCOPe Domain Sequences for d1nkia_:

Sequence; same for both SEQRES and ATOM records:

>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]}
mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
aacrqapyagmrfa

Timeline for d1nkia_:

• d1nkia_ first appeared in SCOP 1.67
  
• d1nkia_ appears in SCOPe 2.06
  
• d1nkia_ appears in the current release, SCOPe 2.08