Lineage for d1nkca2 (1nkc A:469-876)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 517943Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 517944Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 517945Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (31 PDB entries)
  8. 517953Domain d1nkca2: 1nkc A:469-876 [91938]
    Other proteins in same PDB: d1nkca1

Details for d1nkca2

PDB Entry: 1nkc (more details), 1.8 Å

PDB Description: a bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after five rounds of primer extension, following incorporation of dctp, dgtp, dttp, and datp.

SCOP Domain Sequences for d1nkca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkca2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOP Domain Coordinates for d1nkca2:

Click to download the PDB-style file with coordinates for d1nkca2.
(The format of our PDB-style files is described here.)

Timeline for d1nkca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nkca1