SCOP 1.71: Domain d1njxa1: 1njx A:297-468

Lineage for d1njxa1 (1njx A:297-468)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
   contains Pfam 00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (32 PDB entries)

8. Domain d1njxa1: 1njx A:297-468 [91915]
   Other proteins in same PDB: d1njxa2
   complexed with mg, so4, suc

Details for d1njxa1

PDB Entry: 1njx, 1.65 Å

PDB Description: thymine-guanine mismatch at the polymerase active site

SCOP Domain Sequences for d1njxa1:

Sequence; same for both SEQRES and ATOM records:

>d1njxa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d1njxa1:

• d1njxa1 first appeared in SCOP 1.67
  
• d1njxa1 appears in SCOP 1.69
  
• d1njxa1 appears in SCOP 1.73
  
• d1njxa1 appears in the current release, SCOPe 2.08