Lineage for d1njjb2 (1njj B:44-283)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437734Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2437735Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2437786Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 2437792Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51426] (5 PDB entries)
    Uniprot P07805
  8. 2437806Domain d1njjb2: 1njj B:44-283 [91908]
    Other proteins in same PDB: d1njja1, d1njjb1, d1njjc1, d1njjd1
    complexed with get, orx

Details for d1njjb2

PDB Entry: 1njj (more details), 2.45 Å

PDB Description: crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1njjb2:

Sequence, based on SEQRES records: (download)

>d1njjb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristddslar
crlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgt
elgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

Sequence, based on observed residues (ATOM records): (download)

>d1njjb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
dlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigv
ppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlristvkfgak
vedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhild
igggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasa

SCOPe Domain Coordinates for d1njjb2:

Click to download the PDB-style file with coordinates for d1njjb2.
(The format of our PDB-style files is described here.)

Timeline for d1njjb2: