Lineage for d1niqc_ (1niq C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410374Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 410375Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 410404Family d.32.1.2: Antibiotic resistance proteins [54598] (4 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 410405Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 410406Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 410420Domain d1niqc_: 1niq C: [91892]
    complexed with blm, cu

Details for d1niqc_

PDB Entry: 1niq (more details)

PDB Description: solution structure of the hoo-bm bound blmt, transposon tn5-encoding bleomycin-binding protein

SCOP Domain Sequences for d1niqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1niqc_ d.32.1.2 (C:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqnel
lagis

SCOP Domain Coordinates for d1niqc_:

Click to download the PDB-style file with coordinates for d1niqc_.
(The format of our PDB-style files is described here.)

Timeline for d1niqc_: