Lineage for d1nioa_ (1nio A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2605957Protein Beta-luffin [103331] (1 species)
  7. 2605958Species Smooth loofah (Luffa cylindrica) [TaxId:3670] [103332] (1 PDB entry)
  8. 2605959Domain d1nioa_: 1nio A: [91890]
    complexed with nag

Details for d1nioa_

PDB Entry: 1nio (more details), 2 Å

PDB Description: crystal structure of beta-luffin, a ribosome inactivating protein at 2.0a resolution
PDB Compounds: (A:) b-luffin

SCOPe Domain Sequences for d1nioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nioa_ d.165.1.1 (A:) Beta-luffin {Smooth loofah (Luffa cylindrica) [TaxId: 3670]}
anvsfslsgadsksyskfitalrkalpskekvsniplllpsasgasryilmqlsnydaka
itmaidvtnvyimgylvnstsyffnesdaklasqyvfkgstivtlpysgnyerlqnaagk
vrekiplgfrafdsaitslfhydstaaagaflviiqttaeasrfkyiegqiikripknev
pspaalslenewsalskqiqlaqtnngafrtpvviidnkgqrveikdvnskvvtnnikll
lnkqnia

SCOPe Domain Coordinates for d1nioa_:

Click to download the PDB-style file with coordinates for d1nioa_.
(The format of our PDB-style files is described here.)

Timeline for d1nioa_: