![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Beta-luffin [103331] (1 species) |
![]() | Species Smooth loofah (Luffa cylindrica) [TaxId:3670] [103332] (1 PDB entry) |
![]() | Domain d1nioa_: 1nio A: [91890] complexed with nag |
PDB Entry: 1nio (more details), 2 Å
SCOPe Domain Sequences for d1nioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nioa_ d.165.1.1 (A:) Beta-luffin {Smooth loofah (Luffa cylindrica) [TaxId: 3670]} anvsfslsgadsksyskfitalrkalpskekvsniplllpsasgasryilmqlsnydaka itmaidvtnvyimgylvnstsyffnesdaklasqyvfkgstivtlpysgnyerlqnaagk vrekiplgfrafdsaitslfhydstaaagaflviiqttaeasrfkyiegqiikripknev pspaalslenewsalskqiqlaqtnngafrtpvviidnkgqrveikdvnskvvtnnikll lnkqnia
Timeline for d1nioa_: