Lineage for d1ni1a_ (1ni1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010398Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2010399Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2010400Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2010415Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2010509Domain d1ni1a_: 1ni1 A: [91888]
    Other proteins in same PDB: d1ni1b_
    complexed with 2c5, hfp, zn

Details for d1ni1a_

PDB Entry: 1ni1 (more details), 2.3 Å

PDB Description: Imidazole and cyanophenyl farnesyl transferase inhibitors
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1ni1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni1a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqsk

SCOPe Domain Coordinates for d1ni1a_:

Click to download the PDB-style file with coordinates for d1ni1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ni1a_: