Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) |
Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries) |
Domain d1nhxa2: 1nhx A:10-259 [91887] Other proteins in same PDB: d1nhxa1 complexed with edo, ftb, mn, na, pep |
PDB Entry: 1nhx (more details), 2.1 Å
SCOPe Domain Sequences for d1nhxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhxa2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr masrlakeeg
Timeline for d1nhxa2: