SCOP 1.69: Domain d1nhxa2: 1nhx A:10-259

Lineage for d1nhxa2 (1nhx A:10-259)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69616] (6 PDB entries)

8. Domain d1nhxa2: 1nhx A:10-259 [91887]
   Other proteins in same PDB: d1nhxa1

Details for d1nhxa2

PDB Entry: 1nhx, 2.1 Å

PDB Description: pepck complex with a gtp-competitive inhibitor

SCOP Domain Sequences for d1nhxa2:

Sequence; same for both SEQRES and ATOM records:

>d1nhxa2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens)}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

Timeline for d1nhxa2:

• d1nhxa2 first appeared in SCOP 1.67
  
• d1nhxa2 appears in SCOP 1.71
  
• d1nhxa2 appears in the current release, SCOPe 2.08