Lineage for d1nhxa1 (1nhx A:260-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143074Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69612] (2 species)
  7. 2143075Species Human (Homo sapiens) [TaxId:9606] [69613] (7 PDB entries)
  8. 2143077Domain d1nhxa1: 1nhx A:260-622 [91886]
    Other proteins in same PDB: d1nhxa2
    complexed with edo, ftb, mn, na, pep

Details for d1nhxa1

PDB Entry: 1nhx (more details), 2.1 Å

PDB Description: pepck complex with a gtp-competitive inhibitor
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic

SCOPe Domain Sequences for d1nhxa1:

Sequence, based on SEQRES records: (download)

>d1nhxa1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
wlaehmlvlgitnpegekkylaaafpsacgktnlammnpslpgwkvecvgddiawmkfda
qghlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplas
gvtitswknkewssedgepcahpnsrfctpasqcpiidaawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkiimhdpfamrpffgynfgkylahwls
maqhpaaklpkifhvnwfrkdkegkflwpgfgensrvlewmfnridgkastkltpigyip
kedalnlkglghinmmelfsiskefwdkevediekylvdqvnadlpceiereilalkqri
sqm

Sequence, based on observed residues (ATOM records): (download)

>d1nhxa1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
wlaehmlvlgitnpegekkylaaafpsacgktnlammnpslpgwkvecvgddiawmkfda
qghlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplas
gvtitswknkewssedgepcahpnsrfctpasqcpiidaawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseakiimhdpfamrpffgynfgkylahwlsmaqhpaak
lpkifhvnwfrkdkegkflwpgfgensrvlewmfnridgkastkltpigyipkedalnlk
glghinmmelfsiskefwdkevediekylvdqvnadlpceiereilalkqrisqm

SCOPe Domain Coordinates for d1nhxa1:

Click to download the PDB-style file with coordinates for d1nhxa1.
(The format of our PDB-style files is described here.)

Timeline for d1nhxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhxa2