Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein MTH807, thioredoxin/glutaredoxin-like protein [102433] (1 species) behaves as true thioredoxin; probable MJ0307 ortholog |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [102434] (1 PDB entry) |
Domain d1nhoa_: 1nho A: [91885] |
PDB Entry: 1nho (more details)
SCOPe Domain Sequences for d1nhoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Methanobacterium thermoautotrophicum [TaxId: 145262]} mvvnievftsptcpycpmaievvdeakkefgdkidvekidimvdrekaieyglmavpaia ingvvrfvgapsreelfeaindeme
Timeline for d1nhoa_: