Lineage for d1nhoa_ (1nho A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876174Protein MTH807, thioredoxin/glutaredoxin-like protein [102433] (1 species)
    behaves as true thioredoxin; probable MJ0307 ortholog
  7. 2876175Species Methanobacterium thermoautotrophicum [TaxId:145262] [102434] (1 PDB entry)
  8. 2876176Domain d1nhoa_: 1nho A: [91885]

Details for d1nhoa_

PDB Entry: 1nho (more details)

PDB Description: Structural and Functional characterization of a Thioredoxin-like Protein from Methanobacterium thermoautotrophicum
PDB Compounds: (A:) Probable Thioredoxin

SCOPe Domain Sequences for d1nhoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mvvnievftsptcpycpmaievvdeakkefgdkidvekidimvdrekaieyglmavpaia
ingvvrfvgapsreelfeaindeme

SCOPe Domain Coordinates for d1nhoa_:

Click to download the PDB-style file with coordinates for d1nhoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nhoa_: