SCOP 1.69: Domain d1nhcf_: 1nhc F:

Lineage for d1nhcf_ (1nhc F:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (11 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.3: Galacturonase [51137] (2 proteins)
   this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain

6. Protein Polygalacturonase [51140] (6 species)

7. Species Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId:5061] [101950] (1 PDB entry)

8. Domain d1nhcf_: 1nhc F: [91884]

Details for d1nhcf_

PDB Entry: 1nhc, 1.7 Å

PDB Description: structural insights into the processivity of endopolygalacturonase i from aspergillus niger

SCOP Domain Sequences for d1nhcf_:

Sequence; same for both SEQRES and ATOM records:

>d1nhcf_ b.80.1.3 (F:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I}
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc

Timeline for d1nhcf_:

• d1nhcf_ first appeared in SCOP 1.67
  
• d1nhcf_ appears in SCOP 1.71
  
• d1nhcf_ appears in the current release, SCOPe 2.08