Lineage for d1nhce_ (1nhc E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380828Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 380829Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 380870Family b.80.1.3: Galacturonase [51137] (2 proteins)
    this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain
  6. 380871Protein Polygalacturonase [51140] (6 species)
  7. 380878Species Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId:5061] [101950] (1 PDB entry)
  8. 380883Domain d1nhce_: 1nhc E: [91883]

Details for d1nhce_

PDB Entry: 1nhc (more details), 1.7 Å

PDB Description: structural insights into the processivity of endopolygalacturonase i from aspergillus niger

SCOP Domain Sequences for d1nhce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhce_ b.80.1.3 (E:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I}
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc

SCOP Domain Coordinates for d1nhce_:

Click to download the PDB-style file with coordinates for d1nhce_.
(The format of our PDB-style files is described here.)

Timeline for d1nhce_: