SCOPe 2.07: Domain d1nhcd_: 1nhc D:

Lineage for d1nhcd_ (1nhc D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.3: Galacturonase [51137] (3 proteins)
   this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain

6. Protein Polygalacturonase [51140] (6 species)

7. Species Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId:5061] [101950] (1 PDB entry)

8. Domain d1nhcd_: 1nhc D: [91882]
   complexed with gol, man, nag, so4

Details for d1nhcd_

PDB Entry: 1nhc, 1.7 Å

PDB Description: structural insights into the processivity of endopolygalacturonase i from aspergillus niger

PDB Compounds: (D:) Polygalacturonase I

SCOPe Domain Sequences for d1nhcd_:

Sequence; same for both SEQRES and ATOM records:

>d1nhcd_ b.80.1.3 (D:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}
stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc

Timeline for d1nhcd_:

• d1nhcd_ first appeared in SCOP 1.67
  
• d1nhcd_ appears in SCOPe 2.06
  
• d1nhcd_ appears in the current release, SCOPe 2.08